2.20 Rating by ClearWebStats
jmdmotors.in is 1 decade 2 years 4 months old. This website is a sub-domain of in. This website has a #5,951,439 rank in global traffic. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, jmdmotors.in is SAFE to browse.
Get Custom Widget

Traffic Report of Jmdmotors

Daily Unique Visitors: 81
Daily Pageviews: 162

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 5,951,439
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View jmdmotors.in site advisor rating Not Applicable

Where is jmdmotors.in server located?

Hosted IP Address:

162.241.148.33 View other site hosted with jmdmotors.in

Hosted Country:

jmdmotors.in hosted country US jmdmotors.in hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View jmdmotors.in HTML resources

Homepage Links Analysis

JMD Motors – Car Workshop

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 4
H3 Headings: 10 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 24
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

jmdmotors.in favicon - jenniferchemsales.com

View jmdmotors.in Pagerank   jmdmotors.in alexa rank Not Applicable   jmdmotors.in website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

jmdmotors.in favicon - shrivishwakarmasafetytraininginstitute.com

View jmdmotors.in Pagerank   jmdmotors.in alexa rank Not Applicable   jmdmotors.in website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

jmdmotors.in favicon - theshineenglishacademy.com

View jmdmotors.in Pagerank   jmdmotors.in alexa rank Not Applicable   jmdmotors.in website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

jmdmotors.in favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View jmdmotors.in Pagerank   jmdmotors.in alexa rank Not Applicable   jmdmotors.in website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

jmdmotors.in favicon - 247bestpillpharma.com

View jmdmotors.in Pagerank   jmdmotors.in alexa rank Not Applicable   jmdmotors.in website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 04 Jun 2019 18:05:06 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.3
Link: <http://jmdmotors.in/wp-json/>; rel="https://api.w.org/", <http://jmdmotors.in/>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 7583
Content-Type: text/html; charset=UTF-8

Domain Information for jmdmotors.in

Domain Registrar: OVH sas jmdmotors.in registrar info
Registration Date: 2011-12-21 1 decade 2 years 4 months ago
Last Modified: 2018-12-06 5 years 5 months 3 days ago

DNS Record Analysis

Host Type TTL Extra
jmdmotors.in A 14399 IP:162.241.148.33
jmdmotors.in NS 21599 Target:ns2.bh-ht-17.webhostbox.net
jmdmotors.in NS 21599 Target:ns1.bh-ht-17.webhostbox.net
jmdmotors.in SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019053005
Refresh:86400
Retry:7200
Expire:3600000
jmdmotors.in MX 14399 Target:jmdmotors.in
jmdmotors.in TXT 14399 TXT:v=spf1 +a +mx +ip4:162.241.148.33 ~all

Similarly Ranked Websites to Jmdmotors

TKM Institute of Management – TIM Since 1995

jmdmotors.in favicon - tkmim.org

View jmdmotors.in Pagerank   Alexa rank for jmdmotors.in 5,951,441   website value of jmdmotors.in $ 240.00

Belleville Area Humane Society

jmdmotors.in favicon - bahspets.com

Belleville Area Humane Society. It is the mission of the Belleville Area Humane Society to find safe and secure homes for the animals in our care. Each director, staff member, and volunteer works diligently to provide a clean and comfortable temporary home for our 'residents.' Each member of our group actively assists in finding these residents their 'forever home'. It is also our mission to do all of this with the least amount of expense,...

View jmdmotors.in Pagerank   Alexa rank for jmdmotors.in 5,951,453   website value of jmdmotors.in $ 240.00

Vapor Cig, Quit Smoking | Riverside, CA

jmdmotors.in favicon - vaporcig.com

Vapor Cig based in Riverside, California, is proud to bring you this state-of-the-art electronic cigarette, sometimes referred to as an e-cig or e-cigarette.

View jmdmotors.in Pagerank   Alexa rank for jmdmotors.in 5,951,456   website value of jmdmotors.in $ 240.00

Homeguard Security Systems Ltd

jmdmotors.in favicon - homeguardsecurity.co.uk

Leeds, West Yorkshire, UK based company offering wireless and wired home security alarm systems. Other areas include CCTV security and fire alarm systems.

View jmdmotors.in Pagerank   Alexa rank for jmdmotors.in 5,951,473   website value of jmdmotors.in $ 240.00

Carro e Frota

jmdmotors.in favicon - carroefrota.com.br

View jmdmotors.in Pagerank   Alexa rank for jmdmotors.in 5,951,475   website value of jmdmotors.in $ 240.00